Product Added to your Cart
x

-------- OR --------

GBP
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Menu
0 items
Elf
3 product(s) found for "Elf"
Traris Games - Ogre A for Bl..
Blood Bowl
Traris Games - Ogre A for Bl..
A Traris Games Ogre for fantasy football games such as blood bowl. The figure is 45mm in height (not including slotta). The item is supplied with a base.
£6.99
Units in Stock: 5
£6.99
Details
Add To Cart
A Traris Games Ogre for fantasy football games such as blood bowl. The figure is 45mm in height (not including slotta). The item is supplied with a base.
Traris Games - Ogre B for Bl..
Blood Bowl
Traris Games - Ogre B for Bl..
A Traris Games Ogre for fantasy football games such as blood bowl. The figure is 45mm in height (not including slotta). The item is supplied with a base.
£8.99
Units in Stock: 5
£8.99
Details
Add To Cart
A Traris Games Ogre for fantasy football games such as blood bowl. The figure is 45mm in height (not including slotta). The item is supplied with a base.
Treeman for Fantasy Football..
Blood Bowl
Treeman for Fantasy Football..
A resin Treeman minitaure for use in tabletop games such as warhammer and bloodbowl. Figure is 65mm in height and comes supplied with a circular base.
£9.99
Units in Stock: 5
£9.99
Details
Add To Cart
A resin Treeman minitaure for use in tabletop games such as warhammer and bloodbowl. Figure is 65mm in height and comes supplied with a circular base.
Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i